Scaffold Ga0215015_10203814

Overview

Basic Information

• Taxon OID: 3300021046
• Scaffold ID: Ga0215015_10203814
• Source Dataset Name: Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Colorado
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1339
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Czos Across The Us

Source Dataset Sampling Location

• Location Name: Huntingdon County, Pennsylvania, United States
• Coordinates
  • Lat. (^o): 40.6949
  • Long. (^o): -77.9199
  • Depth (m): .9

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040820	Metagenome / Metatranscriptome	161	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0215015_102038142	F040820	N/A	YAVRLPGLRVAWKQHVGGAPFGLLLHRGRLFVSLFDGASVVELEPATGNLVAAHPVPPGPAVLTVDGAGNVVVAGTRGQLNIIGGGRLAAGNGFGVAYAGGRLWSADYERAELVPAGDDHRVGMPAPVFPFWLAAGPGGTLLIAAEGAPEDTAAGGVFSFDTATGVFKTLATPKDPDQVLQSGSTVFAAAHGEHAVLAIRDGKASAWAQGIEAVGLAADPQLSMLVVVVNTHE